Lineage for d3n1ra_ (3n1r A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563508Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2563509Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2563514Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 2563521Protein Sonic hedgehog [55171] (1 species)
  7. 2563522Species Mouse (Mus musculus) [TaxId:10090] [55172] (4 PDB entries)
  8. 2563526Domain d3n1ra_: 3n1r A: [181805]
    automated match to d1vhha_
    complexed with ca, zn

Details for d3n1ra_

PDB Entry: 3n1r (more details), 2.13 Å

PDB Description: Crystal Structure of ShhN
PDB Compounds: (A:) Sonic hedgehog protein

SCOPe Domain Sequences for d3n1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1ra_ d.65.1.2 (A:) Sonic hedgehog {Mouse (Mus musculus) [TaxId: 10090]}
ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrlm
tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky
gmlarlaveagfdwvyyeskahihcsvkae

SCOPe Domain Coordinates for d3n1ra_:

Click to download the PDB-style file with coordinates for d3n1ra_.
(The format of our PDB-style files is described here.)

Timeline for d3n1ra_: