SCOPe 2.05: Domain d3n1qd_: 3n1q D:

Lineage for d3n1qd_ (3n1q D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (27 PDB entries)

8. Domain d3n1qd_: 3n1q D: [181802]
   Other proteins in same PDB: d3n1qa_, d3n1qb_, d3n1qe_
   automated match to d1x4ya1
   complexed with ca, zn

Details for d3n1qd_

PDB Entry: 3n1q, 2.89 Å

PDB Description: Crystal Structure of DhhN bound to CDOFn3

PDB Compounds: (D:) Cell adhesion molecule-related/down-regulated by oncogenes

SCOPe Domain Sequences for d3n1qd_:

Sequence, based on SEQRES records:

>d3n1qd_ b.1.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gphiayteavsdtqimlkwtyipssnnntpiqgfyiyyrptdsdndsdykrdvvegskqw
hmighlqpetsydikmqcfneggesefsnvmicetk

Sequence, based on observed residues (ATOM records):

>d3n1qd_ b.1.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gphiayteavsdtqimlkwtyiqgfyiyyrptdsdndsdykrdvvegskqwhmighlqpe
tsydikmqcfneggesefsnvmicetk

Timeline for d3n1qd_:

• d3n1qd_ first appeared in SCOPe 2.01
  
• d3n1qd_ appears in SCOPe 2.04
  
• d3n1qd_ appears in SCOPe 2.06
  
• d3n1qd_ appears in the current release, SCOPe 2.08