Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein automated matches [190888] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188282] (27 PDB entries) |
Domain d3n1qc_: 3n1q C: [181801] Other proteins in same PDB: d3n1qa_, d3n1qb_, d3n1qe_ automated match to d1x4ya1 complexed with ca, zn |
PDB Entry: 3n1q (more details), 2.89 Å
SCOPe Domain Sequences for d3n1qc_:
Sequence, based on SEQRES records: (download)
>d3n1qc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gphiayteavsdtqimlkwtyipssnnntpiqgfyiyyrptdsdndsdykrdvvegskqw hmighlqpetsydikmqcfneggesefsnvmicetk
>d3n1qc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gphiayteavsdtqimlkwtyiqgfyiyyrptdsdndsdykrdvvegskqwhmighlqpe tsydikmqcfneggesefsnvmicetk
Timeline for d3n1qc_: