Lineage for d1aeia_ (1aei A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000087Protein Annexin XII [47889] (2 species)
  7. 2000088Species Hydra (Hydra attenuata) [TaxId:6087] [47890] (1 PDB entry)
  8. 2000089Domain d1aeia_: 1aei A: [18180]
    complexed with ca

Details for d1aeia_

PDB Entry: 1aei (more details), 2.8 Å

PDB Description: crystal structure of the annexin xii hexamer
PDB Compounds: (A:) annexin xii

SCOPe Domain Sequences for d1aeia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aeia_ a.65.1.1 (A:) Annexin XII {Hydra (Hydra attenuata) [TaxId: 6087]}
vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
csgdykdlllqitgh

SCOPe Domain Coordinates for d1aeia_:

Click to download the PDB-style file with coordinates for d1aeia_.
(The format of our PDB-style files is described here.)

Timeline for d1aeia_: