![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) ![]() zinc-binding motif |
![]() | Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins) |
![]() | Protein automated matches [190324] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188953] (11 PDB entries) |
![]() | Domain d3n1oa_: 3n1o A: [181794] automated match to d1vhha_ complexed with ca, zn |
PDB Entry: 3n1o (more details), 2.55 Å
SCOPe Domain Sequences for d3n1oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n1oa_ d.65.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} klvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkdeentgadrl mtqrckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrnk ygllarlaveagfdwvyyeskahvhcsvkse
Timeline for d3n1oa_: