Lineage for d3n1oa_ (3n1o A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956780Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2956781Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2956786Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 2956800Protein automated matches [190324] (2 species)
    not a true protein
  7. 2956801Species Human (Homo sapiens) [TaxId:9606] [188953] (17 PDB entries)
  8. 2956817Domain d3n1oa_: 3n1o A: [181794]
    automated match to d1vhha_
    complexed with ca, zn

Details for d3n1oa_

PDB Entry: 3n1o (more details), 2.55 Å

PDB Description: Crystal structure of IhhN
PDB Compounds: (A:) Indian hedgehog protein

SCOPe Domain Sequences for d3n1oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1oa_ d.65.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkdeentgadrl
mtqrckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrnk
ygllarlaveagfdwvyyeskahvhcsvkse

SCOPe Domain Coordinates for d3n1oa_:

Click to download the PDB-style file with coordinates for d3n1oa_.
(The format of our PDB-style files is described here.)

Timeline for d3n1oa_: