SCOPe 2.01: Domain d3n1mc_: 3n1m C:

Lineage for d3n1mc_ (3n1m C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (9 PDB entries)

8. Domain d3n1mc_: 3n1m C: [181792]
   Other proteins in same PDB: d3n1mb_
   automated match to d1x4ya1
   complexed with ca, zn

Details for d3n1mc_

PDB Entry: 3n1m, 1.69 Å

PDB Description: Crystal Structure of IhhN bound to BOCFn3

PDB Compounds: (C:) Brother of CDO

SCOPe Domain Sequences for d3n1mc_:

Sequence; same for both SEQRES and ATOM records:

>d3n1mc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erpvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdykkdmve
gdkywhsishlqpetsydikmqcfneggesefsnvmicetkark

Timeline for d3n1mc_:

• d3n1mc_ is new in SCOPe 2.01-stable
  
• d3n1mc_ appears in SCOPe 2.02
  
• d3n1mc_ appears in the current release, SCOPe 2.08