Lineage for d3n1mc_ (3n1m C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762155Protein automated matches [190888] (2 species)
    not a true protein
  7. 2762158Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)
  8. 2762166Domain d3n1mc_: 3n1m C: [181792]
    Other proteins in same PDB: d3n1mb_
    automated match to d1x4ya1
    complexed with ca, zn

Details for d3n1mc_

PDB Entry: 3n1m (more details), 1.69 Å

PDB Description: Crystal Structure of IhhN bound to BOCFn3
PDB Compounds: (C:) Brother of CDO

SCOPe Domain Sequences for d3n1mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1mc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erpvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdykkdmve
gdkywhsishlqpetsydikmqcfneggesefsnvmicetkark

SCOPe Domain Coordinates for d3n1mc_:

Click to download the PDB-style file with coordinates for d3n1mc_.
(The format of our PDB-style files is described here.)

Timeline for d3n1mc_: