Lineage for d3n1la_ (3n1l A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2162927Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 2162928Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 2162986Family d.18.1.0: automated matches [191638] (1 protein)
    not a true family
  6. 2162987Protein automated matches [191174] (3 species)
    not a true protein
  7. 2162990Species Potato (Solanum tuberosum) [TaxId:4113] [189417] (8 PDB entries)
  8. 2162995Domain d3n1la_: 3n1l A: [181790]
    automated match to d1l3aa_
    protein/DNA complex

Details for d3n1la_

PDB Entry: 3n1l (more details), 2.35 Å

PDB Description: Crystal Structure of a StWhy2-rcERE32 complex
PDB Compounds: (A:) protein StWhy2

SCOPe Domain Sequences for d3n1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1la_ d.18.1.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
grvfapysvfkgkaalsaeprlptfnrldsggvklnrrgvimltfwpsvgerkydwekrq
lfalsatevgslismgtrdsseffhdpsmlssnagqvrkslsikpnadgsgyfislsvvn
nnlktndrftvpvttaefavmrtafsfalphimgwdrftnr

SCOPe Domain Coordinates for d3n1la_:

Click to download the PDB-style file with coordinates for d3n1la_.
(The format of our PDB-style files is described here.)

Timeline for d3n1la_: