Lineage for d1avca2 (1avc A:351-671)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000081Protein Annexin VI [47887] (1 species)
    further duplication: consists of two four-domain units
  7. 2000082Species Cow (Bos taurus) [TaxId:9913] [47888] (2 PDB entries)
  8. 2000084Domain d1avca2: 1avc A:351-671 [18179]
    complexed with ca

Details for d1avca2

PDB Entry: 1avc (more details), 2.9 Å

PDB Description: bovine annexin vi (calcium-bound)
PDB Compounds: (A:) annexin vi

SCOPe Domain Sequences for d1avca2:

Sequence, based on SEQRES records: (download)

>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]}
velkgtvrpagdfnpdadakalrkamkglgtdedtiidiithrsnaqrqqirqtfkshfg
rdlmadlkselsgdlarlilglmmppahydakqlkkamegagtdekalieilatrtnaei
qainkaykedyhktledalssdtsghfkrilislatgnreeggedreraredaqvaaeil
eiadttsgdkssletrfmmilctrsypdlrrvfqefvkmtnydvehtikkemsgdvrdvf
vaivqsvknkplffadklyksmkgagteektltrimvsrseidllnirrefiekydkslh
qaiegdtsghflkallaicgg

Sequence, based on observed residues (ATOM records): (download)

>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]}
velkgtvrpagdfnpdadakalrkamkglgtdedtiidiithrsnaqrqqirqtfkshfg
rdlmadlkselsgdlarlilglmmppahydakqlkkamegagtdekalieilatrtnaei
qainkaykedyhktledalssdtsghfkrilislatgnreeggedreraredaqvaaeil
trfmmilctrsypdlrrvfqefvkmtnydvehtikkemsgdvrdvfvaivqsvknkplff
adklyksmkgagteektltrimvsrseidllnirrefiekydkslhqaiegdtsghflka
llaicgg

SCOPe Domain Coordinates for d1avca2:

Click to download the PDB-style file with coordinates for d1avca2.
(The format of our PDB-style files is described here.)

Timeline for d1avca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1avca1