| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein automated matches [190888] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
| Domain d3n1fc_: 3n1f C: [181781] Other proteins in same PDB: d3n1fa_, d3n1fb_, d3n1fd2 automated match to d1x4ya1 complexed with ca, zn |
PDB Entry: 3n1f (more details), 1.6 Å
SCOPe Domain Sequences for d3n1fc_:
Sequence, based on SEQRES records: (download)
>d3n1fc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pitgphiayteavsdtqimlkwtyipssnnntpiqgfyiyyrptdsdndsdykrdvvegs
kqwhmighlqpetsydikmqcfneggesefsnvmicetk
>d3n1fc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pitgphiayteavsdtqimlkwtyiptpiqgfyiyyrptdsdndsdykrdvvegskqwhm
ighlqpetsydikmqcfneggesefsnvmicetk
Timeline for d3n1fc_:
View in 3DDomains from other chains: (mouse over for more information) d3n1fa_, d3n1fb_, d3n1fd1, d3n1fd2 |