SCOPe 2.05: Domain d3n1cd_: 3n1c D:

Lineage for d3n1cd_ (3n1c D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (37 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189558] (5 PDB entries)

8. Domain d3n1cd_: 3n1c D: [181777]
   automated match to d2abqa1
   complexed with f6p

Details for d3n1cd_

PDB Entry: 3n1c, 2 Å

PDB Description: crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate

PDB Compounds: (D:) 6-phosphofructokinase isozyme 2

SCOPe Domain Sequences for d3n1cd_:

Sequence; same for both SEQRES and ATOM records:

>d3n1cd_ c.72.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddt
qkiyaylsr

Timeline for d3n1cd_:

• d3n1cd_ first appeared in SCOPe 2.01
  
• d3n1cd_ appears in SCOPe 2.04
  
• d3n1cd_ appears in SCOPe 2.06
  
• d3n1cd_ appears in the current release, SCOPe 2.08