Lineage for d3n1ca_ (3n1c A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904695Species Escherichia coli K-12 [TaxId:83333] [189558] (5 PDB entries)
  8. 2904698Domain d3n1ca_: 3n1c A: [181774]
    automated match to d2abqa1
    complexed with f6p

Details for d3n1ca_

PDB Entry: 3n1c (more details), 2 Å

PDB Description: crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate
PDB Compounds: (A:) 6-phosphofructokinase isozyme 2

SCOPe Domain Sequences for d3n1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1ca_ c.72.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddt
qkiyaylsr

SCOPe Domain Coordinates for d3n1ca_:

Click to download the PDB-style file with coordinates for d3n1ca_.
(The format of our PDB-style files is described here.)

Timeline for d3n1ca_: