Lineage for d1bcza_ (1bcz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738953Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 1738954Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 1738955Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 1738983Protein Annexin V [47883] (3 species)
  7. 1739004Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)
  8. 1739020Domain d1bcza_: 1bcz A: [18177]
    complexed with ca, so4; mutant

Details for d1bcza_

PDB Entry: 1bcz (more details), 2.2 Å

PDB Description: recombinant rat annexin v, t72s mutant
PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1bcza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcza_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkselsgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

SCOPe Domain Coordinates for d1bcza_:

Click to download the PDB-style file with coordinates for d1bcza_.
(The format of our PDB-style files is described here.)

Timeline for d1bcza_: