Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest |
Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) |
Family c.140.1.0: automated matches [191555] (1 protein) not a true family |
Protein automated matches [190957] (3 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [189077] (3 PDB entries) |
Domain d3n0sd_: 3n0s D: [181763] automated match to d2nyga1 complexed with aco, epe, mg; mutant |
PDB Entry: 3n0s (more details), 2.15 Å
SCOPe Domain Sequences for d3n0sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n0sd_ c.140.1.0 (D:) automated matches {Bacillus anthracis [TaxId: 198094]} namndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmev iteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfr typnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyds ntsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmg kignakcrlmkqrdivdfgtewfrk
Timeline for d3n0sd_: