SCOPe 2.08: Domain d3n0sd1: 3n0s D:1-263

Lineage for d3n0sd1 (3n0s D:1-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest

4. Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families)

5. Family c.140.1.0: automated matches [191555] (1 protein)
   not a true family

6. Protein automated matches [190957] (7 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [189077] (3 PDB entries)

8. Domain d3n0sd1: 3n0s D:1-263 [181763]
   Other proteins in same PDB: d3n0sa2, d3n0sb2, d3n0sc2, d3n0sd2
   automated match to d2nyga1
   complexed with aco, epe, mg; mutant

Details for d3n0sd1

PDB Entry: 3n0s, 2.15 Å

PDB Description: crystal structure of ba2930 mutant (h183a) in complex with accoa

PDB Compounds: (D:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3n0sd1:

Sequence; same for both SEQRES and ATOM records:

>d3n0sd1 c.140.1.0 (D:1-263) automated matches {Bacillus anthracis [TaxId: 198094]}
mndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevit
eegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrty
pnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsnt
svalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgki
gnakcrlmkqrdivdfgtewfrk

Timeline for d3n0sd1:

• d3n0sd1 first appeared in SCOPe 2.01, called d3n0sd_
  
• d3n0sd1 appears in SCOPe 2.07