Lineage for d3n0sa1 (3n0s A:1-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923433Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2923434Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2923450Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 2923451Protein automated matches [190957] (7 species)
    not a true protein
  7. 2923465Species Bacillus anthracis [TaxId:198094] [189077] (3 PDB entries)
  8. 2923470Domain d3n0sa1: 3n0s A:1-263 [181760]
    Other proteins in same PDB: d3n0sa2, d3n0sb2, d3n0sc2, d3n0sd2
    automated match to d2nyga1
    complexed with aco, epe, mg; mutant

Details for d3n0sa1

PDB Entry: 3n0s (more details), 2.15 Å

PDB Description: crystal structure of ba2930 mutant (h183a) in complex with accoa
PDB Compounds: (A:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3n0sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n0sa1 c.140.1.0 (A:1-263) automated matches {Bacillus anthracis [TaxId: 198094]}
mndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevit
eegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrty
pnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsnt
svalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgki
gnakcrlmkqrdivdfgtewfrk

SCOPe Domain Coordinates for d3n0sa1:

Click to download the PDB-style file with coordinates for d3n0sa1.
(The format of our PDB-style files is described here.)

Timeline for d3n0sa1: