Lineage for d1bcw__ (1bcw -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.65: Annexin [47873] (1 superfamily) Superfamily a.65.1: Annexin [47874] (1 family) 
Family a.65.1.1: Annexin [47875] (7 proteins) 
Protein Annexin V [47883] (3 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (9 PDB entries) 
Domain d1bcw__: 1bcw - [18176]
Details for d1bcw__
PDB Entry: 1bcw (more details), 2.1 Å
PDB Description: recombinant rat annexin v, t72a mutant
SCOP Domain Sequences for d1bcw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcw__ a.65.1.1 (-) Annexin V {Rat (Rattus norvegicus)}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkselagkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd
SCOP Domain Coordinates for d1bcw__:
Click to download the PDB-style file with coordinates for d1bcw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bcw__:
- d1bcw__ appears in SCOP 1.57
- d1bcw__ appears in the current release, SCOPe 2.08, called d1bcwa_
View in 3D