Lineage for d3n0lb1 (3n0l B:1-414)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132376Species Campylobacter jejuni [TaxId:197] [189298] (7 PDB entries)
  8. 2132378Domain d3n0lb1: 3n0l B:1-414 [181758]
    Other proteins in same PDB: d3n0la2, d3n0lb2
    automated match to d1dfoa_
    complexed with so4

Details for d3n0lb1

PDB Entry: 3n0l (more details), 1.8 Å

PDB Description: crystal structure of serine hydroxymethyltransferase from campylobacter jejuni
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d3n0lb1:

Sequence, based on SEQRES records: (download)

>d3n0lb1 c.67.1.0 (B:1-414) automated matches {Campylobacter jejuni [TaxId: 197]}
mslemfdkeifdltnkelerqceglemiasenftlpevmevmgsiltnkyaegypgkryy
ggcefvdeietlaierckklfnckfanvqpnsgsqanqgvyaalinpgdkilgmdlshgg
hlthgakvsssgkmyescfygveldgridyekvreiakkekpklivcgasayarvidfak
freiadeigaylfadiahiaglvvagehpspfpyahvvsstthktlrgprggiimtndee
lakkinsaifpgiqggplmhviaakavgfkfnlsdewkvyakqvrtnaqvlanvlmdrkf
klvsdgtdnhlvlmsfldrefsgkdadlalgnagitankntvpgeirspfitsglrlgtp
altargfkekemeivsnyiadilddvnneklqenikqelkklasnfiiyeramf

Sequence, based on observed residues (ATOM records): (download)

>d3n0lb1 c.67.1.0 (B:1-414) automated matches {Campylobacter jejuni [TaxId: 197]}
mslemfdkeifdltnkelerqceglemiasenftlpevmevmgsiltnkyaegypgkryy
ggcefvdeietlaierckklfnckfanvqpnsgsqanqgvyaalinpgdkilgmdlkmye
scfygveldgridyekvreiakkekpklivcgasayarvidfakfreiadeigaylfadi
ahiaglvvagehpspfpyahvvsstthktlrgprggiimtndeelakkinsaifpgiqgg
plmhviaakavgfkfnlsdewkvyakqvrtnaqvlanvlmdrkfklvsdgtdnhlvlmsf
ldrefsgkdadlalgnagitankntvpgeirspfitsglrlgtpaltargfkekemeivs
nyiadilddvnneklqenikqelkklasnfiiyeramf

SCOPe Domain Coordinates for d3n0lb1:

Click to download the PDB-style file with coordinates for d3n0lb1.
(The format of our PDB-style files is described here.)

Timeline for d3n0lb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n0lb2