Class b: All beta proteins [48724] (178 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein Adenovirus fiber protein "knob" domain [49837] (18 species) |
Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries) Uniprot Q64823 182-365 ! Uniprot Q64823 181-365 |
Domain d3n0ic_: 3n0i C: [181756] automated match to d1uxaa_ complexed with zn |
PDB Entry: 3n0i (more details), 1.65 Å
SCOPe Domain Sequences for d3n0ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n0ic_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus 37 [TaxId: 52275]} trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi aqe
Timeline for d3n0ic_: