| Class b: All beta proteins [48724] (180 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
| Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
| Protein Adenovirus fiber protein 'knob' domain [49837] (18 species) |
| Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries) Uniprot Q64823 182-365 ! Uniprot Q64823 181-365 |
| Domain d3n0ic_: 3n0i C: [181756] automated match to d1uxaa_ complexed with zn |
PDB Entry: 3n0i (more details), 1.65 Å
SCOPe Domain Sequences for d3n0ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n0ic_ b.21.1.1 (C:) Adenovirus fiber protein 'knob' domain {Human adenovirus 37 [TaxId: 52275]}
trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
aqe
Timeline for d3n0ic_: