| Class b: All beta proteins [48724] (180 folds) |
| Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
| Family b.17.1.0: automated matches [191496] (1 protein) not a true family |
| Protein automated matches [190806] (3 species) not a true protein |
| Species Chlamydia trachomatis [TaxId:272561] [189391] (1 PDB entry) |
| Domain d3n08a1: 3n08 A:1-149 [181741] Other proteins in same PDB: d3n08a2, d3n08b2 automated match to d1fuxa_ complexed with ca, cl |
PDB Entry: 3n08 (more details), 1.25 Å
SCOPe Domain Sequences for d3n08a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n08a1 b.17.1.0 (A:1-149) automated matches {Chlamydia trachomatis [TaxId: 272561]}
mqltsqafsygrpipkkyscqgvgispplsfsdvpreakslvlivedpdvppsvredglw
ihwivynlspvvsnlaegaqifavqglntageigycppcppdakhryyfyayaldvvlsd
eegvtkeqlleamdghiiataelmgtyek
Timeline for d3n08a1: