SCOPe 2.08: Domain d3n08a1: 3n08 A:1-149

Lineage for d3n08a1 (3n08 A:1-149)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.0: automated matches [191496] (1 protein)
   not a true family

6. Protein automated matches [190806] (3 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:272561] [189391] (1 PDB entry)

8. Domain d3n08a1: 3n08 A:1-149 [181741]
   Other proteins in same PDB: d3n08a2, d3n08b2
   automated match to d1fuxa_
   complexed with ca, cl

Details for d3n08a1

PDB Entry: 3n08, 1.25 Å

PDB Description: Crystal Structure of a Putative PhosphatidylEthanolamine-Binding Protein (PEBP) Homolog CT736 from Chlamydia trachomatis D/UW-3/CX

PDB Compounds: (A:) Putative PhosphatidylEthanolamine-Binding Protein (PEBP)

SCOPe Domain Sequences for d3n08a1:

Sequence; same for both SEQRES and ATOM records:

>d3n08a1 b.17.1.0 (A:1-149) automated matches {Chlamydia trachomatis [TaxId: 272561]}
mqltsqafsygrpipkkyscqgvgispplsfsdvpreakslvlivedpdvppsvredglw
ihwivynlspvvsnlaegaqifavqglntageigycppcppdakhryyfyayaldvvlsd
eegvtkeqlleamdghiiataelmgtyek

Timeline for d3n08a1:

• d3n08a1 first appeared in SCOPe 2.01, called d3n08a_
  
• d3n08a1 appears in SCOPe 2.07