Lineage for d1bc1a_ (1bc1 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738953Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 1738954Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 1738955Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 1738983Protein Annexin V [47883] (3 species)
  7. 1739004Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)
  8. 1739014Domain d1bc1a_: 1bc1 A: [18173]
    complexed with ca, so4; mutant

Details for d1bc1a_

PDB Entry: 1bc1 (more details), 2.05 Å

PDB Description: recombinant rat annexin v, quadruple mutant (t72k, s144k, s228k, s303k)
PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1bc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc1a_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtkgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretkgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tkgdykkallllcggedd

SCOPe Domain Coordinates for d1bc1a_:

Click to download the PDB-style file with coordinates for d1bc1a_.
(The format of our PDB-style files is described here.)

Timeline for d1bc1a_: