SCOPe 2.07: Domain d1bcya_: 1bcy A:

Lineage for d1bcya_ (1bcy A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)

8. Domain d1bcya_: 1bcy A: [18172]
   complexed with ca, so4; mutant

Details for d1bcya_

PDB Entry: 1bcy, 1.95 Å

PDB Description: recombinant rat annexin v, t72k mutant

PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1bcya_:

Sequence; same for both SEQRES and ATOM records:

>d1bcya_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

Timeline for d1bcya_:

• d1bcya_ first appeared (with stable ids) in SCOP 1.55, called d1bcy__
  
• d1bcya_ appears in SCOPe 2.06
  
• d1bcya_ appears in the current release, SCOPe 2.08