Lineage for d1bcya_ (1bcy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717115Protein Annexin V [47883] (3 species)
  7. 2717136Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)
  8. 2717144Domain d1bcya_: 1bcy A: [18172]
    complexed with ca, so4; mutant

Details for d1bcya_

PDB Entry: 1bcy (more details), 1.95 Å

PDB Description: recombinant rat annexin v, t72k mutant
PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1bcya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcya_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

SCOPe Domain Coordinates for d1bcya_:

Click to download the PDB-style file with coordinates for d1bcya_.
(The format of our PDB-style files is described here.)

Timeline for d1bcya_: