Lineage for d3myya_ (3myy A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982188Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 982189Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 982449Protein automated matches [190177] (5 species)
    not a true protein
  7. 982457Species Escherichia coli K-12 [TaxId:83333] [189043] (6 PDB entries)
  8. 982466Domain d3myya_: 3myy A: [181718]
    automated match to d1a0oa_
    complexed with bef, gol, mn, so4; mutant

Details for d3myya_

PDB Entry: 3myy (more details), 2.1 Å

PDB Description: structure of e. coli chey mutant a113p bound to beryllium fluoride
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3myya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3myya_ c.23.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftpatleekln
kifeklgm

SCOPe Domain Coordinates for d3myya_:

Click to download the PDB-style file with coordinates for d3myya_.
(The format of our PDB-style files is described here.)

Timeline for d3myya_: