Lineage for d1a8ba_ (1a8b A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330207Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2330208Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2330209Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2330237Protein Annexin V [47883] (3 species)
  7. 2330258Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)
  8. 2330264Domain d1a8ba_: 1a8b A: [18171]
    complexed with ca, gpe

Details for d1a8ba_

PDB Entry: 1a8b (more details), 1.9 Å

PDB Description: rat annexin v complexed with glycerophosphoethanolamine
PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1a8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8ba_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

SCOPe Domain Coordinates for d1a8ba_:

Click to download the PDB-style file with coordinates for d1a8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1a8ba_: