Lineage for d3myre_ (3myr E:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453668Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1453669Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1453755Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 1453756Protein automated matches [191172] (2 species)
    not a true protein
  7. 1453757Species Allochromatium vinosum [TaxId:1049] [189415] (1 PDB entry)
  8. 1453760Domain d3myre_: 3myr E: [181709]
    Other proteins in same PDB: d3myrb_, d3myrd_, d3myrf_, d3myrh_
    automated match to d1h2as_
    complexed with cl, f3s, imd, mg, nfv, sf4

Details for d3myre_

PDB Entry: 3myr (more details), 2.1 Å

PDB Description: crystal structure of [nife] hydrogenase from allochromatium vinosum in its ni-a state
PDB Compounds: (E:) Hydrogenase (NiFe) small subunit HydA

SCOPe Domain Sequences for d3myre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3myre_ e.19.1.0 (E:) automated matches {Allochromatium vinosum [TaxId: 1049]}
arrpsviwlsfqectgctesltrahaptledlildfisldyhhtlqaasgeaaeaarlqa
mdenrgqylvivdgsipgpdanpgfstvaghsnysilmetvehaaaviavgtcaafgglp
qarpnptgamsvmdlvrdkpvinvpgcppipmvitgviahylvfgrlpeldgygrplafy
gqsihdrcyrrpfydkglfaesfddegakqgwclyrlgckgpttynacatmkwndgtswp
veaghpclgcsepqfwdaggfyepvsvp

SCOPe Domain Coordinates for d3myre_:

Click to download the PDB-style file with coordinates for d3myre_.
(The format of our PDB-style files is described here.)

Timeline for d3myre_: