Lineage for d3mynb_ (3myn B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686003Protein Dehaloperoxidase [46530] (1 species)
  7. 2686004Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)
  8. 2686066Domain d3mynb_: 3myn B: [181703]
    automated match to d1ew6a_
    complexed with cyn, hem, so4; mutant

Details for d3mynb_

PDB Entry: 3myn (more details), 2.19 Å

PDB Description: Mutation of Methionine-86 in Dehaloperoxidase-hemoglobin: Effects of the Asp-His-Fe Triad in a 3/3 Globin
PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d3mynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mynb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqdkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3mynb_:

Click to download the PDB-style file with coordinates for d3mynb_.
(The format of our PDB-style files is described here.)

Timeline for d3mynb_: