Lineage for d2rana_ (2ran A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002518Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2002519Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2002520Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2002548Protein Annexin V [47883] (3 species)
  7. 2002569Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)
  8. 2002575Domain d2rana_: 2ran A: [18170]
    complexed with ca, so4

Details for d2rana_

PDB Entry: 2ran (more details), 1.89 Å

PDB Description: rat annexin v crystal structure: ca2+-induced conformational changes
PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d2rana_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rana_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcgge

SCOPe Domain Coordinates for d2rana_:

Click to download the PDB-style file with coordinates for d2rana_.
(The format of our PDB-style files is described here.)

Timeline for d2rana_: