SCOP 1.71: Domain d2ran__: 2ran -

Lineage for d2ran__ (2ran -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (1 family)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (9 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (13 PDB entries)

8. Domain d2ran__: 2ran - [18170]
   complexed with ca, so4

Details for d2ran__

PDB Entry: 2ran, 1.9 Å

PDB Description: rat annexin v crystal structure: ca2+-induced conformational changes

SCOP Domain Sequences for d2ran__:

Sequence; same for both SEQRES and ATOM records:

>d2ran__ a.65.1.1 (-) Annexin V {Rat (Rattus norvegicus)}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcgge

Timeline for d2ran__:

• d2ran__ first appeared (with stable ids) in SCOP 1.55
  
• d2ran__ appears in SCOP 1.69
  
• d2ran__ is called d2rana_ in SCOP 1.73
  
• d2ran__ appears in the current release, SCOPe 2.08, called d2rana_