![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily) 3 short helices; irregular array |
![]() | Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) ![]() |
![]() | Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins) |
![]() | Protein Villin [47052] (2 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries) |
![]() | Domain d3myaa_: 3mya A: [181693] automated match to d1qqva_ |
PDB Entry: 3mya (more details), 2.5 Å
SCOPe Domain Sequences for d3myaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3myaa_ a.14.1.1 (A:) Villin {Chicken (Gallus gallus) [TaxId: 9031]} ptkletfpldvlvntaaedlprgvdpsrkenflsdedfkavfgmtrsafanlplwkqqnl kkekglf
Timeline for d3myaa_: