Lineage for d3my1a_ (3my1 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586917Protein Cell division protein kinase 9, CDK9 [160810] (1 species)
  7. 2586918Species Human (Homo sapiens) [TaxId:9606] [160811] (6 PDB entries)
    Uniprot P50750 8-325
  8. 2586921Domain d3my1a_: 3my1 A: [181689]
    Other proteins in same PDB: d3my1b1, d3my1b2
    automated match to d3blha1
    complexed with gol, po4, rfz

Details for d3my1a_

PDB Entry: 3my1 (more details), 2.8 Å

PDB Description: Structure of CDK9/cyclinT1 in complex with DRB
PDB Compounds: (A:) Cell division protein kinase 9

SCOPe Domain Sequences for d3my1a_:

Sequence, based on SEQRES records: (download)

>d3my1a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
dsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalr
eikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlse
ikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnry
tnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlc
gsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqrid
sddalnhdffwsdpmpsdlkgm

Sequence, based on observed residues (ATOM records): (download)

>d3my1a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
dsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalr
eikilqllkhenvvnlieicrtkkgsiylvfdfcehdlagllsnvlvkftlseikrvmqm
llnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtl
wyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpev
wpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnh
dffwsdpmpsdlkgm

SCOPe Domain Coordinates for d3my1a_:

Click to download the PDB-style file with coordinates for d3my1a_.
(The format of our PDB-style files is described here.)

Timeline for d3my1a_: