SCOPe 2.07: Domain d3mxxa1: 3mxx A:31-334

Lineage for d3mxxa1 (3mxx A:31-334)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (91 PDB entries)

8. Domain d3mxxa1: 3mxx A:31-334 [181688]
   Other proteins in same PDB: d3mxxa2
   automated match to d1vyhc1
   mutant

Details for d3mxxa1

PDB Entry: 3mxx, 2.05 Å

PDB Description: Crystal structure of WDR5 mutant (S62A)

PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d3mxxa1:

Sequence; same for both SEQRES and ATOM records:

>d3mxxa1 b.69.4.0 (A:31-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlaassadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

Timeline for d3mxxa1:

• d3mxxa1 first appeared in SCOPe 2.01, called d3mxxa_
  
• d3mxxa1 appears in SCOPe 2.06
  
• d3mxxa1 appears in the current release, SCOPe 2.08