Lineage for d3mxxa1 (3mxx A:31-334)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066122Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2066123Protein automated matches [190568] (6 species)
    not a true protein
  7. 2066160Species Human (Homo sapiens) [TaxId:9606] [187559] (46 PDB entries)
  8. 2066196Domain d3mxxa1: 3mxx A:31-334 [181688]
    Other proteins in same PDB: d3mxxa2
    automated match to d1vyhc1
    mutant

Details for d3mxxa1

PDB Entry: 3mxx (more details), 2.05 Å

PDB Description: Crystal structure of WDR5 mutant (S62A)
PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d3mxxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mxxa1 b.69.4.0 (A:31-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlaassadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

SCOPe Domain Coordinates for d3mxxa1:

Click to download the PDB-style file with coordinates for d3mxxa1.
(The format of our PDB-style files is described here.)

Timeline for d3mxxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mxxa2