Lineage for d3mxwa_ (3mxw A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563508Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2563509Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2563514Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 2563528Protein automated matches [190324] (2 species)
    not a true protein
  7. 2563529Species Human (Homo sapiens) [TaxId:9606] [188953] (17 PDB entries)
  8. 2563537Domain d3mxwa_: 3mxw A: [181687]
    Other proteins in same PDB: d3mxwl1, d3mxwl2
    automated match to d1vhha_
    complexed with ca, so4, zn

Details for d3mxwa_

PDB Entry: 3mxw (more details), 1.83 Å

PDB Description: Crystal structure Sonic hedgehog bound to the 5E1 fab fragment
PDB Compounds: (A:) Sonic hedgehog protein

SCOPe Domain Sequences for d3mxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mxwa_ d.65.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltplaykqfipnvaektlgasgryegkisrnserfkeltpnynpdiifkdeentgadrlm
tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky
gmlarlaveagfdwvyyeskahihcsvkaensv

SCOPe Domain Coordinates for d3mxwa_:

Click to download the PDB-style file with coordinates for d3mxwa_.
(The format of our PDB-style files is described here.)

Timeline for d3mxwa_: