SCOPe 2.01: Domain d3mxta_: 3mxt A:

Lineage for d3mxta_ (3mxt A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (13 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [189366] (3 PDB entries)

8. Domain d3mxta_: 3mxt A: [181686]
   automated match to d1v8fa_
   complexed with cl, fmt, gol, mg, so4

Details for d3mxta_

PDB Entry: 3mxt, 1.85 Å

PDB Description: Crystal Structure of Pantoate-Beta-alanine Ligase from Campylobacter jejuni

PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3mxta_:

Sequence; same for both SEQRES and ATOM records:

>d3mxta_ c.26.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
amqvitsvkeakqivkdwkshqlsigyvptmgflhdghlslvkhaktqdkvivsifvnpm
qfgpnedfssyprdlerdikmcqdngvdmvfipdatqmylknfstyvdmntitdklcgak
rpghfrgvctvltkffnilnpdivymgqkdaqqcvvvrhmvddlnfdlkiqicpiireed
glakssrnvylskeerkaslaisqsiflaeklvregekntskiiqamkdilekeklikid
yielvdfntmenienitdnvlgavaafvgktrlidnflvqglk

Timeline for d3mxta_:

• d3mxta_ is new in SCOPe 2.01-stable
  
• d3mxta_ appears in SCOPe 2.02
  
• d3mxta_ appears in the current release, SCOPe 2.08, called d3mxta1