SCOPe 2.01: Domain d3mxpa_: 3mxp A:

Lineage for d3mxpa_ (3mxp A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190761] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [188650] (14 PDB entries)

8. Domain d3mxpa_: 3mxp A: [181683]
   automated match to d1joka_
   complexed with ca, thp

Details for d3mxpa_

PDB Entry: 3mxp, 1.61 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs t62a at cryogenic temperature

PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d3mxpa_:

Sequence; same for both SEQRES and ATOM records:

>d3mxpa_ b.40.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafakkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws

Timeline for d3mxpa_:

• d3mxpa_ is new in SCOPe 2.01-stable
  
• d3mxpa_ appears in SCOPe 2.02
  
• d3mxpa_ appears in the current release, SCOPe 2.08