SCOPe 2.05: Domain d3mxjb_: 3mxj B:

Lineage for d3mxjb_ (3mxj B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein Three prime repair exonuclease 1, TREX1 [159631] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [159632] (6 PDB entries)
   Uniprot Q91XB0 5-234! Uniprot Q91XB0 9-234

8. Domain d3mxjb_: 3mxj B: [181680]
   automated match to d2ioca1

Details for d3mxjb_

PDB Entry: 3mxj, 1.95 Å

PDB Description: Crystal Structure of the mTREX1 Apoprotein

PDB Compounds: (B:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d3mxjb_:

Sequence, based on SEQRES records:

>d3mxjb_ c.55.3.5 (B:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
qtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprv
vdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclva
hngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiy
trlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records):

>d3mxjb_ c.55.3.5 (B:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
qtlphghmqtlifldleatglpssrpevtelcllavhrralentsghpppvprpprvvdk
lslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahng
drydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdsh
taegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Timeline for d3mxjb_:

• d3mxjb_ first appeared in SCOPe 2.01
  
• d3mxjb_ appears in SCOPe 2.04
  
• d3mxjb_ appears in SCOPe 2.06
  
• d3mxjb_ appears in the current release, SCOPe 2.08