SCOP 1.57: Domain d1hakb_: 1hak B:

Lineage for d1hakb_ (1hak B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)

4. Superfamily a.65.1: Annexin [47874] (1 family)

5. Family a.65.1.1: Annexin [47875] (7 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)

8. Domain d1hakb_: 1hak B: [18168]

Details for d1hakb_

PDB Entry: 1hak, 3 Å

PDB Description: crystal structure of recombinant human placental annexin v complexed with k-201 as a calcium channel activity inhibitor

SCOP Domain Sequences for d1hakb_:

Sequence; same for both SEQRES and ATOM records:

>d1hakb_ a.65.1.1 (B:) Annexin V {Human (Homo sapiens)}
qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcgedd

Timeline for d1hakb_:

• d1hakb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hakb_ appears in SCOP 1.59
  
• d1hakb_ appears in the current release, SCOPe 2.08