Lineage for d3mxgj_ (3mxg J:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949389Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 949843Protein automated matches [190381] (4 species)
    not a true protein
  7. 949855Species Escherichia coli O157:H7 [TaxId:83334] [189598] (1 PDB entry)
  8. 949865Domain d3mxgj_: 3mxg J: [181675]
    automated match to d1r4pb_
    complexed with xls; mutant

Details for d3mxgj_

PDB Entry: 3mxg (more details), 2.49 Å

PDB Description: structure of shiga toxin type 2 (stx2) b pentamer mutant q40l
PDB Compounds: (J:) Shiga-like toxin 2 subunit B

SCOPe Domain Sequences for d3mxgj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mxgj_ b.40.2.1 (J:) automated matches {Escherichia coli O157:H7 [TaxId: 83334]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOPe Domain Coordinates for d3mxgj_:

Click to download the PDB-style file with coordinates for d3mxgj_.
(The format of our PDB-style files is described here.)

Timeline for d3mxgj_: