Lineage for d1haka_ (1hak A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002518Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2002519Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2002520Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2002548Protein Annexin V [47883] (3 species)
  7. 2002553Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)
  8. 2002567Domain d1haka_: 1hak A: [18167]
    complexed with k21

Details for d1haka_

PDB Entry: 1hak (more details), 3 Å

PDB Description: crystal structure of recombinant human placental annexin v complexed with k-201 as a calcium channel activity inhibitor
PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1haka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1haka_ a.65.1.1 (A:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcgedd

SCOPe Domain Coordinates for d1haka_:

Click to download the PDB-style file with coordinates for d1haka_.
(The format of our PDB-style files is described here.)

Timeline for d1haka_: