Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (4 species) not a true protein |
Species Escherichia coli O157:H7 [TaxId:83334] [189598] (1 PDB entry) |
Domain d3mxgd_: 3mxg D: [181669] automated match to d1r4pb_ complexed with xls; mutant |
PDB Entry: 3mxg (more details), 2.49 Å
SCOPe Domain Sequences for d3mxgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mxgd_ b.40.2.1 (D:) automated matches {Escherichia coli O157:H7 [TaxId: 83334]} adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs gfaevqfnnd
Timeline for d3mxgd_: