| Class b: All beta proteins [48724] (177 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein automated matches [190381] (8 species) not a true protein |
| Species Escherichia coli O157:H7 [TaxId:83334] [189598] (1 PDB entry) |
| Domain d3mxga_: 3mxg A: [181666] automated match to d1r4pb_ complexed with xls; mutant |
PDB Entry: 3mxg (more details), 2.49 Å
SCOPe Domain Sequences for d3mxga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mxga_ b.40.2.1 (A:) automated matches {Escherichia coli O157:H7 [TaxId: 83334]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd
Timeline for d3mxga_: