Lineage for d1hvga_ (1hvg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717115Protein Annexin V [47883] (3 species)
  7. 2717120Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)
  8. 2717133Domain d1hvga_: 1hvg A: [18166]
    mutant

Details for d1hvga_

PDB Entry: 1hvg (more details), 3 Å

PDB Description: structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1hvga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvga_ a.65.1.1 (A:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
vlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgr
dllddlkseltgkfqklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeelr
aikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqag
elkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvks
irsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgd
tsgdykkallllc

SCOPe Domain Coordinates for d1hvga_:

Click to download the PDB-style file with coordinates for d1hvga_.
(The format of our PDB-style files is described here.)

Timeline for d1hvga_: