Lineage for d3mxbr_ (3mxb R:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966038Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2966049Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2966050Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 2966106Protein automated matches [190411] (4 species)
    not a true protein
  7. 2966119Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [187286] (9 PDB entries)
  8. 2966130Domain d3mxbr_: 3mxb R: [181659]
    automated match to d1t9ib_
    protein/DNA complex; complexed with ca, po4

Details for d3mxbr_

PDB Entry: 3mxb (more details), 2.3 Å

PDB Description: Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus
PDB Compounds: (R:) v3(e8k)

SCOPe Domain Sequences for d3mxbr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mxbr_ d.95.2.1 (R:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkkfllylagfvdgdgsiiaqinpnqsskfkhrlrltfyvtqktqrrwfldklvde
igvgyvrdsgsvsqyvlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravldsl

SCOPe Domain Coordinates for d3mxbr_:

Click to download the PDB-style file with coordinates for d3mxbr_.
(The format of our PDB-style files is described here.)

Timeline for d3mxbr_: