![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
![]() | Superfamily d.95.2: Homing endonucleases [55608] (3 families) ![]() |
![]() | Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins) contains two extra helices in the C-terminal extension |
![]() | Protein automated matches [190411] (4 species) not a true protein |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [187286] (9 PDB entries) |
![]() | Domain d3mxbb_: 3mxb B: [181658] automated match to d1t9ib_ protein/DNA complex; complexed with ca, po4 |
PDB Entry: 3mxb (more details), 2.3 Å
SCOPe Domain Sequences for d3mxbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mxbb_ d.95.2.1 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} ntkyneefllylagfvdsdgsiiaqikprqsnkfkhqlsltfavtqktqrrwfldklvde igvgyvydsgsvsdyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk flevctwvdqiaalndsktrkttsetvravlds
Timeline for d3mxbb_: