SCOPe 2.06: Domain d3mwiu_: 3mwi U:

Lineage for d3mwiu_ (3mwi U:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (79 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d3mwiu_: 3mwi U: [181648]
   automated match to d1ejna_
   complexed with b25, so4

Details for d3mwiu_

PDB Entry: 3mwi, 2.03 Å

PDB Description: the complex crystal structure of urokianse and 5-nitro-1h-indole-2- amidine

PDB Compounds: (U:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3mwiu_:

Sequence; same for both SEQRES and ATOM records:

>d3mwiu_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk

Timeline for d3mwiu_:

• d3mwiu_ first appeared in SCOPe 2.01
  
• d3mwiu_ appears in SCOPe 2.05
  
• d3mwiu_ appears in SCOPe 2.07
  
• d3mwiu_ appears in the current release, SCOPe 2.08