Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
Protein automated matches [190130] (11 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [187244] (5 PDB entries) |
Domain d3mwab1: 3mwa B:1-321 [181647] Other proteins in same PDB: d3mwaa2, d3mwab2 automated match to d2f84a1 complexed with peg, po4, uft |
PDB Entry: 3mwa (more details), 1.75 Å
SCOPe Domain Sequences for d3mwab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mwab1 c.1.2.3 (B:1-321) automated matches {Plasmodium falciparum [TaxId: 36329]} mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp ypqkaaqmyydqinailkqnm
Timeline for d3mwab1: