| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) ![]() |
| Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
| Protein Glutamate dehydrogenase [53225] (8 species) |
| Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries) |
| Domain d3mw9f2: 3mw9 F:1-208 [181645] Other proteins in same PDB: d3mw9a1, d3mw9b1, d3mw9c1, d3mw9d1, d3mw9e1, d3mw9f1 complexed with glu, gtp, nad |
PDB Entry: 3mw9 (more details), 2.4 Å
SCOPe Domain Sequences for d3mw9f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mw9f2 c.58.1.1 (F:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi
Timeline for d3mw9f2: